Puma yagouaroundi (jaguarundi): 121044195 Help Entry 121044195         CDS       T07555                                  Symbol PFN4 Name (RefSeq) profilin-4 isoform X1   KO K05759   profilin Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04015   Rap1 signaling pathway pyu04810   Regulation of actin cytoskeleton pyu05014   Amyotrophic lateral sclerosis pyu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     121044195 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     121044195 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121044195 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     121044195 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pyu04131]     121044195 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pyu04812]     121044195 (PFN4)    04147 Exosome [BR:pyu04147]     121044195 (PFN4) Membrane trafficking [BR:pyu04131]  Others   Actin-binding proteins    Others     121044195 (PFN4) Cytoskeleton proteins [BR:pyu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      121044195 (PFN4) Exosome [BR:pyu04147]  Exosomal proteins   Proteins found in most exosomes    121044195 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  121044195 NCBI-ProteinID:  XP_040352128 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLSVASPGFSVMPSDVRTLVNGFAKNPLQTR REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSVCVEATEKL GEYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagataccctcctgggaacaaagcatgtggacagt gcagccctcatcaaactccaggagcgaagcttgagtgtagcatcaccaggatttagtgta atgcccagtgatgtccgaactcttgtgaatggattcgccaagaaccctttgcaaaccaga agagaaggactgtatttcaaggaaaaggactacaaatgtgtccgggcagatgactattct ctttatgctaagaatgaaaacactggtgtggttgttgtgaagacccatctgtatcttcta gtggcaacttacactgaaggcatgtatcctagtgtttgtgtggaagccacagagaaactg ggagaatatctaagaagaaaaggaaattaa

DBGET integrated database retrieval system