Puma yagouaroundi (jaguarundi): 121044316 Help Entry 121044316         CDS       T07555                                  Symbol DPY30 Name (RefSeq) protein dpy-30 homolog   KO K14965   protein dpy-30 Organism pyu  Puma yagouaroundi (jaguarundi) Brite KEGG Orthology (KO) [BR:pyu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pyu03036]     121044316 (DPY30) Chromosome and associated proteins [BR:pyu03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      121044316 (DPY30)     MLL-HCF complex      121044316 (DPY30)     MLL3/MLL4 complex      121044316 (DPY30) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dpy-30 RIIa DUF7205 Motif Other DBs NCBI-GeneID:  121044316 NCBI-ProteinID:  XP_040352381 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MEPEQMLEGQTQVAENPHSEYGLTDNVERIVDNEKINAEKSSKQKVDLQSLPTRAYLDQT VVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFEDRN NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggagccagagcagatgctggagggacagacgcaggttgcagaaaaccctcactctgag tatggtcttacagacaatgtcgagaggatagtagacaatgagaagattaatgcagaaaag tcatcaaaacagaaagtggatcttcagtctttgccaactcgtgcctacctggatcagaca gttgtgcctatattattacagggactggctgtgcttgcaaaagaaagaccaccaaatccc attgaatttctagcatcatatcttttaaaaaacaaggcacagtttgaagatcgaaactga

DBGET integrated database retrieval system