Puma yagouaroundi (jaguarundi): 121044461 Help Entry 121044461         CDS       T07555                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha isoform X1   KO K04383   interleukin 1 alpha Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04010   MAPK signaling pathway pyu04060   Cytokine-cytokine receptor interaction pyu04217   Necroptosis pyu04218   Cellular senescence pyu04380   Osteoclast differentiation pyu04640   Hematopoietic cell lineage pyu04932   Non-alcoholic fatty liver disease pyu04933   AGE-RAGE signaling pathway in diabetic complications pyu04940   Type I diabetes mellitus pyu05010   Alzheimer disease pyu05020   Prion disease pyu05022   Pathways of neurodegeneration - multiple diseases pyu05133   Pertussis pyu05140   Leishmaniasis pyu05152   Tuberculosis pyu05162   Measles pyu05164   Influenza A pyu05321   Inflammatory bowel disease pyu05323   Rheumatoid arthritis pyu05332   Graft-versus-host disease pyu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121044461 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121044461 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     121044461 (IL1A)    04218 Cellular senescence     121044461 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     121044461 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     121044461 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     121044461 (IL1A)    05162 Measles     121044461 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     121044461 (IL1A)    05152 Tuberculosis     121044461 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     121044461 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     121044461 (IL1A)    05321 Inflammatory bowel disease     121044461 (IL1A)    05332 Graft-versus-host disease     121044461 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     121044461 (IL1A)    05020 Prion disease     121044461 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     121044461 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     121044461 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     121044461 (IL1A)    04932 Non-alcoholic fatty liver disease     121044461 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     121044461 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121044461 (IL1A) Cytokines and neuropeptides [BR:pyu04052]  Cytokines   Interleukins    121044461 (IL1A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep DUF6108 Motif Other DBs NCBI-GeneID:  121044461 NCBI-ProteinID:  XP_040352697 LinkDB All DBs Position Unknown AA seq 270 aa AA seqDB search MAKVPDLFEDLKNCYSENEEYSSEIDHLTLNQKSFYDASYDPLHEDCTDKFMSPSTSETS KTPQLTLKKSVVMVAANGKILKKRRLSLNQFLTADDLEAIANEVEEEIMKPRSVAPNFYS SEKYNYQKIIKSQFILNDNLSQSVIRKAGGKYLAAAALQNLDDAVKFDMGAYTSKEDSKL PVTLRISKTRLFVSAQNEDEPVLLKEMPETPKTIRDETNLLFFWERHGSKNYFKSVAHPK LFIATQEEKLVHMARGLPSVTDFQILETQS NT seq 813 nt NT seq  +upstreamnt  +downstreamnt atggccaaagttcctgacctctttgaagacctgaagaactgttacagtgaaaatgaagaa tacagttctgaaattgaccatctcactctgaatcagaaatccttctatgatgcaagctat gacccacttcatgaggactgtacagataaattcatgtctccgagtacttctgaaacctct aagacaccccagcttaccctcaagaagagtgtggtgatggtggcagccaatgggaagatt ctgaagaagagacggttgagtttaaatcaattcctcactgctgatgacctggaagccatt gccaacgaagtagaagaagaaatcatgaagcccagatcagtagcacccaacttctatagc agtgaaaaatacaactatcagaagatcatcaaatcccaattcatcctgaatgacaacctc agtcaaagtgtaattcgaaaagcagggggaaaatacctcgcagccgctgcattacagaat ctggatgatgcagtgaaatttgacatgggggcttatacatcaaaagaagattctaaactt cctgtgactctcagaatctcaaaaactcgactgtttgtgagtgcccaaaatgaagatgag cctgtattgctaaaggagatgcctgagacacccaaaaccatcagagatgagaccaacctt ctcttcttctgggaacgtcatggcagtaagaactacttcaaatcagttgcccatccaaag ttgttcattgccacacaggaagaaaaactggtgcacatggcaagagggctaccctctgta actgactttcagatactggaaacccagtcttga

DBGET integrated database retrieval system