Puma yagouaroundi (jaguarundi): 121044995 Help Entry 121044995         CDS       T07555                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04081   Hormone signaling pyu04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     121044995 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     121044995 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121044995 (GAST) Cytokines and neuropeptides [BR:pyu04052]  Neuropeptides   GPCR binding    121044995 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  121044995 NCBI-ProteinID:  XP_040353471 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MQRLCVCVLILALALTAFSEASWKPRSQLQDAPSGPGANRGLEPHWLNRLGPASHHRRQL GLQGPPQLVADLSKKQGPWLEEEEAAYGWMDFGRRSAEDGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcaacgactgtgtgtgtgcgtgctgatcttggcactggctctgaccgccttctctgaa gcttcctggaagccccgctcccagctgcaggatgcaccctcgggtccaggggccaacagg ggcctggaaccacattggctgaaccggctgggcccagcctctcaccaccgacggcagcta gggctccagggtcccccacagctggtggcagacctgtccaagaagcagggaccgtggctg gaggaagaagaagcagcgtacggatggatggacttcggccgccgcagtgcagaggacggg gaccaacatccctag

DBGET integrated database retrieval system