Puma yagouaroundi (jaguarundi): 26129876 Help Entry 26129876          CDS       T07555                                  Symbol ND3, ASR42_gp06 Name (RefSeq) NADH dehydrogenase subunit 3   KO K03880   NADH-ubiquinone oxidoreductase chain 3 [EC:7.1.1.2] Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu00190   Oxidative phosphorylation pyu01100   Metabolic pathways pyu04714   Thermogenesis pyu04723   Retrograde endocannabinoid signaling pyu05010   Alzheimer disease pyu05012   Parkinson disease pyu05014   Amyotrophic lateral sclerosis pyu05016   Huntington disease pyu05020   Prion disease pyu05022   Pathways of neurodegeneration - multiple diseases pyu05208   Chemical carcinogenesis - reactive oxygen species pyu05415   Diabetic cardiomyopathy Module pyu_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:pyu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     26129876 (ND3)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     26129876 (ND3)   09159 Environmental adaptation    04714 Thermogenesis     26129876 (ND3)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     26129876 (ND3)   09164 Neurodegenerative disease    05010 Alzheimer disease     26129876 (ND3)    05012 Parkinson disease     26129876 (ND3)    05014 Amyotrophic lateral sclerosis     26129876 (ND3)    05016 Huntington disease     26129876 (ND3)    05020 Prion disease     26129876 (ND3)    05022 Pathways of neurodegeneration - multiple diseases     26129876 (ND3)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     26129876 (ND3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:pyu03029]     26129876 (ND3) Enzymes [BR:pyu01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      26129876 (ND3) Mitochondrial biogenesis [BR:pyu03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     26129876 (ND3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q4 DUF1673 Motif Other DBs NCBI-GeneID:  26129876 NCBI-ProteinID:  YP_009178431 UniProt:  A0A0N7BTR2 LinkDB All DBs Position MT AA seq 115 aa AA seqDB search MNMMITLLTNMLLSTLLVLIAFWLPQLNIYAEKVSPYECGFDPMGSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWASQTNNLPTMLTMALLLISLLAASLAYEWTQKGLEWTE NT seq 347 nt NT seq  +upstreamnt  +downstreamnt ataaacataataattaccctgctcaccaacatgcttctatctacactacttgtactcatc gcattctggttaccccaactaaatatttacgcagaaaaagtaagcccctatgaatgtggg tttgatcctataggatccgcccgtttgcccttttccatgaaattcttcttagtagccatc acatttttgctatttgacctagaaattgcactactactccccctcccctgagcctcacaa acgaataatctaccaaccatactcaccatagccctactactaatctcactactagctgca agcctagcctatgaatgaacccaaaaaggactagaatgaaccgaata

DBGET integrated database retrieval system