Pyrobaculum sp. WP30: PYWP30_01665 Help Entry PYWP30_01665      CDS       T04013                                  Name (GenBank) ACT domain   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism pyw  Pyrobaculum sp. WP30 Pathway pyw00290   Valine, leucine and isoleucine biosynthesis pyw00650   Butanoate metabolism pyw00660   C5-Branched dibasic acid metabolism pyw00770   Pantothenate and CoA biosynthesis pyw01100   Metabolic pathways pyw01110   Biosynthesis of secondary metabolites pyw01210   2-Oxocarboxylic acid metabolism pyw01230   Biosynthesis of amino acids Module pyw_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine pyw_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:pyw00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     PYWP30_01665    00660 C5-Branched dibasic acid metabolism     PYWP30_01665   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     PYWP30_01665   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     PYWP30_01665 Enzymes [BR:pyw01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      PYWP30_01665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  AKT35282 UniProt:  A0A0K1E3L8 LinkDB All DBs Position 1465653..1465892 Genome browser AA seq 79 aa AA seqDB search MRRISISTPKSLDALGRVIAITRRAKVQLVDMVVASEDSMYRVHMKVEGPHDEVQWLVAK LDKLPEVLRIDEGDIDINY NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaggagaattagcatatccacgcctaagtccctcgacgcgctgggacgtgtaattgcc atcacgcgtagagctaaggtccaactcgtggacatggtggtcgcctctgaggactccatg tatagggtgcatatgaaggtggaagggccccacgacgaggtgcagtggcttgttgcgaag cttgacaagcttccggaggtgctgagaatagacgagggagatatcgatataaactactag

DBGET integrated database retrieval system