Pyramidobacter sp. YE332: RAH42_08165 Help Entry RAH42_08165       CDS       T09677                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pyy  Pyramidobacter sp. YE332 Pathway pyy00998   Biosynthesis of various antibiotics pyy01100   Metabolic pathways pyy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pyy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RAH42_08165 (acpP)    00074 Mycolic acid biosynthesis     RAH42_08165 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RAH42_08165 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  WOL39127 LinkDB All DBs Position complement(1732245..1732496) Genome browser AA seq 83 aa AA seqDB search MTKADVLARLKEIIIDRLDVEEEQIRPEASFVEDLGADSLDIVELIMGIEEEFDIEIPDE DAEKLTTVGEAINYAASKLGIEE NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgactaaagcagatgttctcgctcgcctgaaggaaatcatcatcgaccgtcttgacgtg gaagaggagcagatccgccccgaggcttctttcgtggaagatctcggcgccgattccctt gacatcgtcgagctgatcatgggcatcgaggaagagttcgacatcgagattcccgatgag gatgccgaaaagctgaccactgtcggcgaagcgatcaactacgccgccagcaagcttggc atcgaggagtaa

DBGET integrated database retrieval system