Pseudomonas ogarae SWRI108: HU749_021340 Help Entry HU749_021340      CDS       T07889                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pza  Pseudomonas ogarae SWRI108 Pathway pza01100   Metabolic pathways pza01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pza00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HU749_021340 (acpP)    00074 Mycolic acid biosynthesis     HU749_021340 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HU749_021340 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  QXH93373 LinkDB All DBs Position complement(4878231..4878467) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgccgagcaactgggcgttaaagaa gaagaagttgtgaacaccgcttccttcgttgaagacctgggtgccgactcccttgacact gttgagctggtgatggctctggaagaggaattcgagaccgagattcctgacgaagaagct gagaagatcactactgtacaagctgctatcgactacgttaccagccaccaggcgtaa

DBGET integrated database retrieval system