Quatrionicoccus australiensis: KI612_10295 Help Entry KI612_10295       CDS       T07598                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism qau  Quatrionicoccus australiensis Pathway qau01100   Metabolic pathways qau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:qau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KI612_10295    00074 Mycolic acid biosynthesis     KI612_10295   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KI612_10295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UCV13368 LinkDB All DBs Position 2121157..2121426 Genome browser AA seq 89 aa AA seqDB search MNAALCHELKALIIEACDKDCAPEAISDDELLFGPEAPLQLDSLDALQVSMAIKKKYGLR LPDSKETRRILSSVANLAEHLDAWRASRA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaacgccgccctctgccacgaactcaaagccctgatcatcgaagcctgcgacaaggac tgcgcacccgaggcgatcagcgacgacgaactgctgttcgggccggaggcaccgctgcag ctcgattcgctcgatgcgctgcaggtctcgatggcgatcaagaagaaatacggcctgcgc ctgcccgacagcaaggaaacccggcgcatcctgtccagcgtcgccaacctcgccgaacat ctcgacgcctggcgggccagccgcgcatga

DBGET integrated database retrieval system