Quatrionicoccus australiensis: KI612_12885 Help Entry KI612_12885       CDS       T07598                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism qau  Quatrionicoccus australiensis Brite KEGG Orthology (KO) [BR:qau00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:qau03032]     KI612_12885    03036 Chromosome and associated proteins [BR:qau03036]     KI612_12885    03400 DNA repair and recombination proteins [BR:qau03400]     KI612_12885 DNA replication proteins [BR:qau03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     KI612_12885 Chromosome and associated proteins [BR:qau03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     KI612_12885 DNA repair and recombination proteins [BR:qau03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       KI612_12885 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 FIMAH Motif Other DBs NCBI-ProteinID:  UCV13849 LinkDB All DBs Position 2655158..2655430 Genome browser AA seq 90 aa AA seqDB search MNKTELIDQIAASADISKAAAGRALDATVEAVKAALKAGDTVSLIGFGTFYVGERAARTG RNPRTGKTLEIKAAKSPKFRAGKGLKDAIN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaaccgaactgattgaccaaatcgccgcttctgctgatatttccaaggctgcc gctggccgcgccctcgacgctaccgtcgaagccgtcaaggctgccctgaaagccggcgac accgtcagcctgatcggcttcggcactttctacgttggtgaacgcgctgcccgcaccggc cgcaacccgcgcaccggcaagaccctcgaaatcaaggccgccaagtcgccgaagttccgc gccggcaagggcctgaaagacgccatcaactaa

DBGET integrated database retrieval system