Quatrionicoccus australiensis: KI612_17155
Help
Entry
KI612_17155 CDS
T07598
Name
(GenBank) histidine phosphatase family protein
KO
K15634
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:
5.4.2.11
]
Organism
qau
Quatrionicoccus australiensis
Pathway
qau00010
Glycolysis / Gluconeogenesis
qau00260
Glycine, serine and threonine metabolism
qau00680
Methane metabolism
qau01100
Metabolic pathways
qau01110
Biosynthesis of secondary metabolites
qau01120
Microbial metabolism in diverse environments
qau01200
Carbon metabolism
qau01230
Biosynthesis of amino acids
Module
qau_M00002
Glycolysis, core module involving three-carbon compounds
qau_M00003
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:
qau00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00010 Glycolysis / Gluconeogenesis
KI612_17155
09102 Energy metabolism
00680 Methane metabolism
KI612_17155
09105 Amino acid metabolism
00260 Glycine, serine and threonine metabolism
KI612_17155
Enzymes [BR:
qau01000
]
5. Isomerases
5.4 Intramolecular transferases
5.4.2 Phosphotransferases (phosphomutases)
5.4.2.11 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
KI612_17155
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
His_Phos_1
Motif
Other DBs
NCBI-ProteinID:
UCV14637
LinkDB
All DBs
Position
complement(3581837..3582493)
Genome browser
AA seq
218 aa
AA seq
DB search
MVEIPTSQPTRICLVRHGETEWNAERRIQGQIDIGLNENGVRQAEAAGRWLQGTGIVALY
SSDLKRAWTTAQAIGSALGLVPHAAPEMRERRYGVFEGLTYAEAQQKFPDGYAAFEGRNA
DYAFENGESLQVMFARVTGKLQTIAAAHAGQTVAVVLHGGVLDIINRFVRGNSLEMQRDF
LIPNAGLNWIATVDGRWHIESWAETDHLAPGALDELPA
NT seq
657 nt
NT seq
+upstream
nt +downstream
nt
atggtggaaatccctacaagccagccgacccgcatctgcctggtgcgacacggcgagacc
gaatggaatgccgagcgccgcatccaggggcagatcgatatcgggctcaacgaaaatggc
gtgcgccaggccgaggcggccggtcgctggctgcaggggaccggcattgtcgccctttac
agcagcgatctcaagcgtgcctggacgacggcgcaggcgataggttcggctctcggtctg
gtgccgcacgctgcgccggagatgcgcgaacggcgttatggcgtgttcgaaggcctgacc
tacgccgaggcgcagcagaagtttcccgacggttacgccgcatttgaagggcgcaatgcc
gactacgccttcgaaaacggcgagagcctgcaagtgatgttcgcgcgcgtcaccggtaag
ctgcagacaattgccgcggcacatgccggccagacggtggcggtcgtgctgcatggcggc
gtgctcgacatcatcaaccgcttcgtgcgcggcaacagcctcgagatgcagcgcgatttc
ctgatcccgaatgccggcctcaactggatcgcaacggtcgacggccgctggcacatcgaa
agctgggccgaaaccgatcatctggcgccaggcgcccttgatgagcttccggcgtga
DBGET
integrated database retrieval system