Qipengyuania citrea: NCF85_08545 Help Entry NCF85_08545       CDS       T08274                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism qci  Qipengyuania citrea Pathway qci01100   Metabolic pathways qci01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:qci00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCF85_08545    00074 Mycolic acid biosynthesis     NCF85_08545   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCF85_08545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF5783 DUF1493 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  USA60171 LinkDB All DBs Position complement(1792732..1792968) Genome browser AA seq 78 aa AA seqDB search MSDTADRVQKIVVEHLGVEADKVTQEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVGDATKYIEEHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatactgccgaccgcgtgcagaagattgtcgtcgagcatctcggcgtcgaggcc gacaaggtcacccaggaagccagcttcatcgatgatctcggtgcggacagcctcgatatc gtcgagctggtcatggcgttcgaagaagaattcggtgtcgaaatccccgatgacgctgcc gaaaaaatcaccaccgttggtgatgcgaccaagtacatcgaagagcacaagggctaa

DBGET integrated database retrieval system