KEGG   Qipengyuania citrea: NCF85_10030
Entry
NCF85_10030       CDS       T08274                                 
Symbol
truB
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
qci  Qipengyuania citrea
Brite
KEGG Orthology (KO) [BR:qci00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:qci03016]
    NCF85_10030 (truB)
Enzymes [BR:qci01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     NCF85_10030 (truB)
Transfer RNA biogenesis [BR:qci03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    NCF85_10030 (truB)
 Prokaryotic type
    NCF85_10030 (truB)
SSDB
Motif
Pfam: TruB_N TruB_C_2 TruB_C
Other DBs
NCBI-ProteinID: USA60442
UniProt: A0ABY4U2V7
LinkDB
Position
complement(2075897..2076895)
AA seq 332 aa
MSGTKPPSHGWLILDKPRGLGSTQAVSAVKRVLRQGGYAKTKVGHGGTLDPLAEGVLPIA
LGEATKLAGRMLDSEKIYAFTIQFGEETDTLDTEGEVIETSDRRPPMAAIPAVLDHFTGD
IDQVPPAYSAVKIDGKRAYDRARAGEEVEMKTRAVTVYSLDLEGNREDGELRSAFATTAG
RPDPYDPQAPLELADSITLVAHVSKGTYIRSLARDIARALGTLGHVTYLRRIKAGPFTEE
QAISLDKLEEVAKGARIENLLLPLEAGLDDIPALQLDPDSAQAVRQGRVLSELPHADGLH
LATLHDVPVALMELSGGTAKVVRGFNLPDVAE
NT seq 999 nt   +upstreamnt  +downstreamnt
atgagcggcaccaaacccccgtcacatggctggttgatcctcgacaaaccccgcggcctt
ggctcgacgcaggccgtttcggccgtcaagcgtgtgctgcggcagggcggctatgctaag
accaaggtcggccacggcggtacgcttgatccgctggccgaaggagtgttgcccatcgcg
ctgggtgaagcgaccaaactcgccggccgcatgctcgattccgaaaagatctatgccttt
acgatccagttcggcgaagaaaccgacacgctggataccgaaggcgaggtcatcgaaaca
tccgaccgccgcccgccgatggctgcgattccagcagtgcttgatcatttcacaggcgat
atcgatcaggttccgcccgcttattcggctgtaaagatcgatgggaagcgggcttacgat
cgggcgagggccggcgaagaggtcgagatgaagacccgcgccgttacggtgtactcactc
gacctggaaggtaaccgcgaagatggtgaattgcggtccgcttttgccaccaccgcaggc
cgccccgacccttacgatccgcaagccccgctggaactggcagacagcatcacactcgtg
gcgcatgtgtcgaagggcacctacatccgctcgcttgcacgggatatcgcacgcgcgctt
ggaacgctggggcatgtcacctatctgaggcgcatcaaggccggtccgttcaccgaagaa
caggcgatttcgctggacaaactggaggaagtcgctaagggcgcgcgcattgaaaacctc
ctcctgccgctcgaggcggggctggacgacatcccggccttgcaactcgatcccgatagc
gcgcaggcggtccgccagggccgggtactttcggaactgccccatgccgacgggctccac
cttgcgacactgcacgatgtgccggtggccttgatggaactcagcggcggtacggcgaag
gtcgtgcgggggttcaacctaccggatgtcgcggagtaa

DBGET integrated database retrieval system