Qiania dongpingensis: H9Q78_01645 Help Entry H9Q78_01645       CDS       T08121                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism qdo  Qiania dongpingensis Pathway qdo01100   Metabolic pathways qdo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:qdo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H9Q78_01645 (acpP)    00074 Mycolic acid biosynthesis     H9Q78_01645 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H9Q78_01645 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Motif Other DBs NCBI-ProteinID:  QNM05904 UniProt:  A0A7G9G522 LinkDB All DBs Position complement(358933..359163) Genome browser AA seq 76 aa AA seqDB search MEFEKLQGIIAEVLNVETDEITMDTTFVDDLGADSLDIFQIIMGIEEEFDIEIPNEAAEQ IVTVGDAVEQIKNACN NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggaatttgaaaaactacaggggattattgcagaggtattgaatgtagagacggatgag ataacgatggataccacatttgtggatgatctgggggcggattcgctggatatattccag atcatcatgggaatcgaggaagagtttgacatcgagattcccaacgaggcggcggagcag atcgtcacggtgggagacgcggtagagcagatcaagaacgcctgcaattaa

DBGET integrated database retrieval system