Quercus lobata (valley oak): 115950295 Help Entry 115950295         CDS       T07350                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism qlo  Quercus lobata (valley oak) Pathway qlo03083   Polycomb repressive complex qlo04120   Ubiquitin mediated proteolysis qlo04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:qlo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     115950295    04120 Ubiquitin mediated proteolysis     115950295   09126 Chromosome    03083 Polycomb repressive complex     115950295  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:qlo04131]     115950295    04121 Ubiquitin system [BR:qlo04121]     115950295    03036 Chromosome and associated proteins [BR:qlo03036]     115950295 Membrane trafficking [BR:qlo04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     115950295 Ubiquitin system [BR:qlo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      115950295    Cul7 complex      115950295 Chromosome and associated proteins [BR:qlo03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      115950295   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      115950295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 BTB Motif Other DBs NCBI-GeneID:  115950295 NCBI-ProteinID:  XP_030923376 UniProt:  A0A7N2M1V0 LinkDB All DBs Position 6:51300864..51302323 Genome browser AA seq 155 aa AA seqDB search MSSSKKITLKSSDGEAFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYC KKHVESTCADERTSDEDLKAWDTEFVRVDQATLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgtcgaagaagatcaccctgaagagctctgacggtgaggctttcgaagtggag gaggcggtggcgcttgagtctcagacgatcaagcacatgattgaggacgattgcgccgac aacggaatccccctcccgaacgtgacgagcaagatcttggccaaggtcatcgagtactgt aagaagcacgtcgagtccacctgtgccgacgagcgcacctccgacgaagatctcaaggct tgggacaccgagttcgtcagggttgaccaggccaccctcttcgatctcattctggctgca aactatttgaacatcaagagccttttggatttgacatgccagaccgtagcggacatgatc aagggtaagacaccagaggagatccgcaagacctttaacatcaagaatgacttcacccct gaggaagaggaagaggttcgtagggagaatcagtgggcatttgaatga

DBGET integrated database retrieval system