Quercus lobata (valley oak): 115951175 Help Entry 115951175         CDS       T07350                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism qlo  Quercus lobata (valley oak) Brite KEGG Orthology (KO) [BR:qlo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:qlo03041]     115951175   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:qlo04052]     115951175 Spliceosome [BR:qlo03041]  Complex B   Other components    Complex B specific factors     115951175 Cytokines and neuropeptides [BR:qlo04052]  Neuropeptides   Unclassified    115951175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Ubiquitin_4 Rad60-SLD CPDase DUF6361 Motif Other DBs NCBI-GeneID:  115951175 NCBI-ProteinID:  XP_030924216 UniProt:  A0A7N2R8C5 LinkDB All DBs Position 7:complement(44401342..44401643) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTICDLKKLVAAQTGTRADKSRIQKWSNIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatagaggtggtgctgaacgatcggttggggaagaaggttcgtgtgaagtgcaacgag gatgacaccatatgtgacctgaagaagcttgtggcggctcagactggtacaagggccgac aagagtaggatccagaagtggtccaacatctacaaagaccacatcactctcaaggattac gagattcacgatggcatgggcctcgagctctactacaactaa

DBGET integrated database retrieval system