Quercus lobata (valley oak): 115952175 Help Entry 115952175         CDS       T07350                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism qlo  Quercus lobata (valley oak) Brite KEGG Orthology (KO) [BR:qlo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:qlo03041]     115952175   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:qlo04052]     115952175 Spliceosome [BR:qlo03041]  Complex B   Other components    Complex B specific factors     115952175 Cytokines and neuropeptides [BR:qlo04052]  Neuropeptides   Unclassified    115952175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Crinkler Motif Other DBs NCBI-GeneID:  115952175 NCBI-ProteinID:  XP_030925108 UniProt:  A0A7N2M7N8 LinkDB All DBs Position 7:complement(44370844..44376533) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDY EIHDGMGLELYYY NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatagaggtggttctgaacgatcggttggggaagaaggttcgtgtgaagtgcaacgag gatgacaccattggcgacctgaagaaacttgtggcggctcagactggtacaagggccgac aagattaggatccagaagtggtacaacatctacaaagaccacatcactctcaaggattac gagattcacgatggcatgggcctcgagctctactactactaa

DBGET integrated database retrieval system