Quercus lobata (valley oak): 115952875 Help Entry 115952875         CDS       T07350                                  Name (RefSeq) calmodulin-7   KO K02183   calmodulin Organism qlo  Quercus lobata (valley oak) Pathway qlo04016   MAPK signaling pathway - plant qlo04070   Phosphatidylinositol signaling system qlo04075   Plant hormone signal transduction qlo04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:qlo00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     115952875    04070 Phosphatidylinositol signaling system     115952875    04075 Plant hormone signal transduction     115952875  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     115952875  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:qlo01009]     115952875   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:qlo04131]     115952875    03036 Chromosome and associated proteins [BR:qlo03036]     115952875   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:qlo04147]     115952875 Protein phosphatases and associated proteins [BR:qlo01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      115952875 Membrane trafficking [BR:qlo04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     115952875 Chromosome and associated proteins [BR:qlo03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      115952875 Exosome [BR:qlo04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    115952875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 EFhand_Ca_insen DUF5580_M Dockerin_1 RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like DUF6279 Fe_hyd_lg_C MecA_N Motif Other DBs NCBI-GeneID:  115952875 NCBI-ProteinID:  XP_030926065 UniProt:  A0A7N2M3P9 LinkDB All DBs Position 7:complement(15380311..15382402) Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDD EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagaccaactcaccgacgaccagatctctgagttcaaggaggccttcagtttgttc gacaaggatggcgacggttgcatcactaccaaggagcttgggactgtgatgaggtcactg ggccagaacccaactgaggcagagctccaggacatgattaatgaagttgatgccgatggt aatggaaccattgacttccctgagttccttaaccttatggcgaggaagatgaaggacact gattcggaggaggaacttaaagaagcattcagagtttttgacaaggatcagaatgggttc atctctgctgccgagctgcgccatgtgatgaccaacctcggggagaagctcaccgatgat gaagttgatgagatgatcagggaggctgatgttgatggtgatggccagataaattatgag gagtttgtcaaggtgatgatggccaagtga

DBGET integrated database retrieval system