KEGG   Quercus lobata (valley oak): 115959048
Entry
115959048         CDS       T07350                                 

Name
(RefSeq) anthocyanidin 5,3-O-glucosyltransferase-like
  KO
K12938  anthocyanidin 5,3-O-glucosyltransferase [EC:2.4.1.-]
Organism
qlo  Quercus lobata (valley oak)
Pathway
qlo00942  Anthocyanin biosynthesis
Brite
KEGG Orthology (KO) [BR:qlo00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00942 Anthocyanin biosynthesis
    115959048
Enzymes [BR:qlo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     115959048
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-GeneID: 115959048
NCBI-ProteinID: XP_030933199
LinkDB
Position
9
AA seq 472 aa
MENAIVLYPFPGRGHLISMVELGKLILKHNPSFNITILIFNKPNTSTNSTAPQYVASSTA
QYITAVNSTTPSINFHHLPPISEVPSTPSPIAQAFLIPRLNNLNLHQALKTISQTSKLKA
FIIDFFCDAAFEVATNLDIPTYYFYPSGASVLSLFLYIPTLHKKVEKSLKDLGDMLLDIP
GLPPIRASDMPGSISDRTAEWYEYFLNTAAQMAKSNGIIVNTFDLLETKVVKAISDGLCV
QDGPTPPIFCIGPLISSSSQDEDEHECLKWLNSQPSRSVVFLCFGSMGLFSAKQLEEMAL
GLENSGQRFLWVVRNPPPNNEEEPNLDELLPKGFLERTKDRGFVVKQWAPQVEVLSHDSV
GGFVTHCGWNSVLEAISVGMPMVAWPLYAEQRLNRVFLVDEMKVALGLKEMEDGFVSAEE
LEKRVRELIESKAGREVRESVLGFRDEAMIAQKEGGSSHVALAKLAQLLEQT
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggaaaatgccatagttctatacccttttccaggcagaggccatctaatctccatggtc
gagcttggcaagctcatactcaaacataacccttctttcaacatcacaatccttatcttt
aacaaaccaaacacaagtactaactccaccgcaccccaatatgtagccagctctaccgcc
caatacatcaccgctgtcaattccaccactccatctatcaactttcaccacctcccacca
atctccgaagtcccatccactccttcccccatagcacaagccttcctaatcccacgcctc
aacaaccttaatctccatcaagctctcaaaactatttcccaaacctccaaactcaaagcc
tttatcattgatttcttctgtgatgctgctttcgaagtggccacaaaccttgacatcccc
acttactatttctacccctctggcgcaagcgttctatctttgtttctatacatacccact
ttgcataaaaaagtggaaaaaagcttgaaagatctcggtgatatgcttcttgacattcct
ggcttaccgcctatccgagcttcagacatgccaggaagtatatcagatcgtactgctgaa
tggtatgagtatttcttaaacacggcagcccaaatggccaaatcaaatggaattattgta
aacacgtttgatttgctcgaaacaaaagtggtcaaagcaatttcggatggattatgtgtc
caagatggaccaactcctccaatattttgtattggacctttgatatcaagcagcagtcaa
gatgaagatgagcatgagtgtttgaaatggctgaactcccaaccgagtcgaagtgttgtg
tttctgtgttttggaagcatgggattgttttcagcgaaacagttggaagaaatggctctg
ggattggagaatagtgggcaaaggtttttgtgggtggtaagaaatccaccgccaaataat
gaggaagagccaaacttggatgaattattgccaaagggtttcttggaaaggaccaaggat
agggggtttgtagtgaaacaatgggctccacaggtggaagtgctgagtcatgactcggtg
ggtgggttcgtgactcactgtgggtggaactcggtgcttgaagcaattagtgttggtatg
ccaatggttgcgtggcctttgtatgcagagcaaaggttgaacagggtgtttttggtggat
gaaatgaaggtggcattgggtttaaaggagatggaagatgggtttgtgagtgcagaagag
ttggaaaagcgagtgagggagttaattgagtccaaagctgggagagaggtgagagagagt
gttttgggcttcagagatgaagctatgatagcccagaaagaaggtggctcctcccatgtt
gcattagccaaattggcccagttgttggagcaaacctga

DBGET integrated database retrieval system