Quercus lobata (valley oak): 115965298 Help Entry 115965298         CDS       T07350                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism qlo  Quercus lobata (valley oak) Pathway qlo04145   Phagosome qlo04148   Efferocytosis qlo04517   IgSF CAM signaling qlo04518   Integrin signaling qlo04620   Toll-like receptor signaling pathway qlo05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:qlo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     115965298    04518 Integrin signaling     115965298  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     115965298    04148 Efferocytosis     115965298  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     115965298  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     115965298  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:qlo04131]     115965298   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:qlo04147]     115965298    04031 GTP-binding proteins [BR:qlo04031]     115965298 Membrane trafficking [BR:qlo04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     115965298  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     115965298   Macropinocytosis    Ras GTPases     115965298  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     115965298 Exosome [BR:qlo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115965298   Exosomal proteins of other body fluids (saliva and urine)    115965298   Exosomal proteins of colorectal cancer cells    115965298   Exosomal proteins of bladder cancer cells    115965298 GTP-binding proteins [BR:qlo04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     115965298 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  115965298 NCBI-ProteinID:  XP_030940352 LinkDB All DBs Position 10:complement(13486916..13492206) Genome browser AA seq 211 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGL WDTAGQEDYNRLRPLSYRGGDVFVLAFSLVSRASYENVLKKWIPELQHYAPGIPVVLVGT KLDLREDKHYLADHPGMVPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAAIKVVI KPPQKQKEKKKKPRRGCLLNVFRGSSFVCLK NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggcttcaagtgcttcaaggttcatcaagtgtgtgacagttggagatggggctgttggg aagacctgcatgcttatttgctatacaagtaacaaattccccactgattatatacccaca gtgtttgataacttcagtgcaaatgtggtggttgaaggcaccactgttaacttaggactc tgggacacagctgggcaagaggattacaatagattaaggccattgagctacagaggggga gatgtctttgtcttagctttctcactagttagtcgtgcaagctacgaaaacgtacttaaa aagtggatccctgaacttcagcattatgcccctggcattcccgtggttctggttggcacc aaattggatcttcgtgaggataagcactatttggctgatcatccaggaatggtgcctgtg acgactgcacagggtgaggaactccgtaaacagattggtgctgcatattatatagaatgc agctcaaaaactcagcagaatgtgaaagcagtttttgatgctgcaatcaaggtggttatc aaaccaccacagaagcaaaaagagaagaagaaaaagccacgtcgtggatgcctattaaat gtttttcgtgggagcagtttcgtgtgtctcaaatga

DBGET integrated database retrieval system