Quercus lobata (valley oak): 115967085 Help Entry 115967085         CDS       T07350                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism qlo  Quercus lobata (valley oak) Pathway qlo03083   Polycomb repressive complex qlo04120   Ubiquitin mediated proteolysis qlo04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:qlo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     115967085    04120 Ubiquitin mediated proteolysis     115967085   09126 Chromosome    03083 Polycomb repressive complex     115967085  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:qlo04131]     115967085    04121 Ubiquitin system [BR:qlo04121]     115967085    03036 Chromosome and associated proteins [BR:qlo03036]     115967085 Membrane trafficking [BR:qlo04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     115967085 Ubiquitin system [BR:qlo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      115967085    Cul7 complex      115967085 Chromosome and associated proteins [BR:qlo03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      115967085   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      115967085 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  115967085 NCBI-ProteinID:  XP_030942029 LinkDB All DBs Position 11:50774744..50775865 Genome browser AA seq 130 aa AA seqDB search MAMELQTIKDMIEDNYTNSVIPLHNVTSDILELVIEDCKKHVEAAESESEPSCSLASKLI DNPLKAWDVKFIKVHQETLFNLILTVLLGGWVNYFSNFSGGQLSGYLGAVGFDLPSSGRY DGGKHYRSDT NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atggcaatggagttgcagacaataaaggacatgatcgaagacaactacaccaacagtgtg atcccattgcacaatgtcacaagtgacattcttgaacttgtcatcgaggactgcaagaag catgtggaggctgctgagtccgagtctgaaccttcttgttctttggcttccaagctcatc gacaatccactcaaggcctgggatgtcaagttcatcaaggtccaccaagaaacactcttc aacctaattctgactgtcttacttggtggatgggtgaactatttttcaaatttttcaggc ggccaactatctggatatctaggggctgttggatttgacctgccaagcagtggcagatat gatggagggaaacactatagatcagatacataa

DBGET integrated database retrieval system