Quercus lobata (valley oak): 115968830 Help Entry 115968830         CDS       T07350                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism qlo  Quercus lobata (valley oak) Pathway qlo03083   Polycomb repressive complex qlo04120   Ubiquitin mediated proteolysis qlo04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:qlo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     115968830    04120 Ubiquitin mediated proteolysis     115968830   09126 Chromosome    03083 Polycomb repressive complex     115968830  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:qlo04131]     115968830    04121 Ubiquitin system [BR:qlo04121]     115968830    03036 Chromosome and associated proteins [BR:qlo03036]     115968830 Membrane trafficking [BR:qlo04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     115968830 Ubiquitin system [BR:qlo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      115968830    Cul7 complex      115968830 Chromosome and associated proteins [BR:qlo03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      115968830   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      115968830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ DarP Motif Other DBs NCBI-GeneID:  115968830 NCBI-ProteinID:  XP_030944203 UniProt:  A0A7N2N0D7 LinkDB All DBs Position 11:50769350..50771527 Genome browser AA seq 155 aa AA seqDB search MSSVKKVTLKSSDGEIFEVEETVAMESQTIKSLIEDDCADNAIPLPNVTSRILSLVIQYC KEHTSSSDSNSSKSNEELKAWDTQFINVDQNVLFDLIMAANYLNIKGLLDLTSQTVADMI KGKTPEQIRAIFNIVNDFTPEEEEEVRRENAWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcttcggtgaagaaggtgacgctgaagagctcagatggcgagattttcgaggtggaa gagactgtggcgatggagtcacagacgataaagagcttgatcgaagatgactgtgctgac aatgcaatcccattgcctaacgtaacaagccgcatactctcactcgtcatccagtactgc aaggagcacacgtcctcctctgactctaactcttccaagtccaatgaggagctcaaggcc tgggatactcagttcatcaatgtcgaccagaacgtcctctttgatctcattatggcggcc aactatttgaacattaaggggctattggatttaactagccagactgtggcagacatgata aagggaaagactccagaacagattcgtgcgatattcaatattgtgaatgatttcactcca gaagaagaagaggaggttcgaagggagaatgcgtgggcatttgagtga

DBGET integrated database retrieval system