Quercus lobata (valley oak): 115973470 Help Entry 115973470         CDS       T07350                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism qlo  Quercus lobata (valley oak) Pathway qlo03083   Polycomb repressive complex qlo04120   Ubiquitin mediated proteolysis qlo04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:qlo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     115973470    04120 Ubiquitin mediated proteolysis     115973470   09126 Chromosome    03083 Polycomb repressive complex     115973470  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:qlo04131]     115973470    04121 Ubiquitin system [BR:qlo04121]     115973470    03036 Chromosome and associated proteins [BR:qlo03036]     115973470 Membrane trafficking [BR:qlo04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     115973470 Ubiquitin system [BR:qlo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      115973470    Cul7 complex      115973470 Chromosome and associated proteins [BR:qlo03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      115973470   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      115973470 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Motif Other DBs NCBI-GeneID:  115973470 NCBI-ProteinID:  XP_030949595 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MAGGKINGMEKLVVGPLCSGKKCENEEVLVMEGFAGKIDGMEIGEFGFVPFHIQLKLPDD SDMADGKNEYSTSIFLAANYLNIKGLLDLTCKTVADMMKGKTPQEIRDTFHIKNDYTPEE EEEVRRENQWAFE NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atggcgggtgggaagattaatggaatggaaaaacttgttgttggtccattgtgtagtgga aagaagtgtgaaaatgaggaggttttagtaatggaaggatttgctgggaaaattgatgga atggaaataggggagtttggatttgttccattccatatacaactgaaactgcctgatgac tctgacatggctgatggaaaaaatgagtactctactagtatctttttggcggctaactat ttgaatattaaggggttgttggatttaacctgcaagactgttgcagacatgatgaaggga aagactccacaagagattcgcgacacatttcacatcaagaatgattacactccagaggaa gaagaggaagttcggagggagaaccagtgggcatttgagtga

DBGET integrated database retrieval system