Quercus lobata (valley oak): 115974533 Help Entry 115974533         CDS       T07350                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism qlo  Quercus lobata (valley oak) Pathway qlo03083   Polycomb repressive complex qlo04120   Ubiquitin mediated proteolysis qlo04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:qlo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     115974533    04120 Ubiquitin mediated proteolysis     115974533   09126 Chromosome    03083 Polycomb repressive complex     115974533  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:qlo04131]     115974533    04121 Ubiquitin system [BR:qlo04121]     115974533    03036 Chromosome and associated proteins [BR:qlo03036]     115974533 Membrane trafficking [BR:qlo04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     115974533 Ubiquitin system [BR:qlo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      115974533    Cul7 complex      115974533 Chromosome and associated proteins [BR:qlo03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      115974533   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      115974533 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  115974533 NCBI-ProteinID:  XP_030950793 UniProt:  A0A7N2KSS7 LinkDB All DBs Position 2:12405546..12407508 Genome browser AA seq 156 aa AA seqDB search MSSRKITLKSSDGETFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCK KHVETPKAEDRVASTDEELKNWDLEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgaggaagataacgctgaagagctcggacggagagactttcgaggtggaggaa gcggtggcgttggaatctcagacgataaagcacatgattgaagacgattgcgccgacaat ggaatccctctgccgaacgtgaccagcaagatcttgtcgaaggtcatcgagtactgcaaa aagcacgtcgagacaccgaaagccgaggaccgtgtcgcctctaccgatgaggagctcaag aactgggacctcgagtttgtcaaagtcgaccaggccaccctcttcgatctcatcttggct gcaaattatctgaacatcaagagcttgctggatctgacttgccaaacagtggcagacatg atcaagggcaaaacacctgaggaaatccgcaagacgttcaacatcaagaatgacttcaca cccgaggaagaggaggaggttcgcagggagaaccaatgggcctttgagtga

DBGET integrated database retrieval system