Qipengyuania profunda: SD421_12280 Help Entry SD421_12280       CDS       T10896                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism qpr  Qipengyuania profunda Pathway qpr01100   Metabolic pathways qpr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:qpr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SD421_12280    00074 Mycolic acid biosynthesis     SD421_12280   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SD421_12280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF5783 DUF1493 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WPL56227 LinkDB All DBs Position complement(2350920..2351156) Genome browser AA seq 78 aa AA seqDB search MSDTADRVQKIVVEHLGVEADKVTQEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVGDATKYIEEHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatactgccgaccgcgtgcagaaaattgtcgtcgagcacctcggcgtcgaggcc gacaaggtcacccaggaagccagcttcatcgacgatctcggtgcggacagtctcgacatc gtcgagctggtcatggccttcgaagaggaattcggcgtcgaaatccccgacgatgcggct gagaagatcaccaccgtcggcgacgcgaccaagtatatcgaagagcacaagggctaa

DBGET integrated database retrieval system