Quillaja saponaria (soapbark tree): O6P43_002133 Help Entry O6P43_002133      CDS       T09778                                  Name (GenBank) SKP1-like protein   KO K03094   S-phase kinase-associated protein 1 Organism qsa  Quillaja saponaria (soapbark tree) Pathway qsa03083   Polycomb repressive complex qsa04120   Ubiquitin mediated proteolysis qsa04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:qsa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     O6P43_002133    04120 Ubiquitin mediated proteolysis     O6P43_002133   09126 Chromosome    03083 Polycomb repressive complex     O6P43_002133  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:qsa04131]     O6P43_002133    04121 Ubiquitin system [BR:qsa04121]     O6P43_002133    03036 Chromosome and associated proteins [BR:qsa03036]     O6P43_002133 Membrane trafficking [BR:qsa04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     O6P43_002133 Ubiquitin system [BR:qsa04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      O6P43_002133    Cul7 complex      O6P43_002133 Chromosome and associated proteins [BR:qsa03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      O6P43_002133   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      O6P43_002133 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ ASPP2-like_RA Motif Other DBs NCBI-ProteinID:  KAJ7978632 UniProt:  A0AAD7QC13 LinkDB All DBs Position 2 Genome browser AA seq 150 aa AA seqDB search MSAKKITLKSSDGETFQVDEDVALESQTIKHLIEDDCADNVIPVPIVSGQILAKVIEYCK AHFDAGGNNDEILKNWNAEFVKVDQTTLFDLILAANYLNIKSLLDLTCQAVADLIKGKTP EEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgtctgcgaagaagatcacgctcaagagctctgatggcgagaccttccaggtcgacgag gatgtggcacttgaatcacagaccatcaaacacttgattgaggacgattgcgctgataat gtgatccctgtgccaatcgtctccggccaaatcctggccaaggtcatcgagtactgcaag gcgcactttgatgctggcggtaacaatgatgaaatccttaagaactggaacgccgagttt gtcaaggttgaccagaccacgctcttcgacctcatcttggctgcaaactatctgaacatt aagagccttctggatttgacatgccaggctgtggccgacttgatcaaagggaagacccca gaggaaattcgcaagacgttcaacatcaagaatgatttcactcctgaggaagaagaggaa gttcgtagggagaaccaatgggcttttgagtga

DBGET integrated database retrieval system