Quillaja saponaria (soapbark tree): O6P43_004021 Help Entry O6P43_004021      CDS       T09778                                  Name (GenBank) Dynein light chain   KO K10418   dynein light chain LC8-type Organism qsa  Quillaja saponaria (soapbark tree) Pathway qsa04145   Phagocytosis qsa04517   IgSF CAM signaling qsa04814   Motor proteins Brite KEGG Orthology (KO) [BR:qsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     O6P43_004021  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     O6P43_004021   09142 Cell motility    04814 Motor proteins     O6P43_004021  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:qsa03037]     O6P43_004021    04812 Cytoskeleton proteins [BR:qsa04812]     O6P43_004021 Cilium and associated proteins [BR:qsa03037]  Motile cilia and associated proteins   Dynein arm    O6P43_004021 Cytoskeleton proteins [BR:qsa04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      O6P43_004021 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-ProteinID:  KAJ7973856 UniProt:  A0AAD7Q2Y1 LinkDB All DBs Position 3:complement(1068272..1069179) Genome browser AA seq 94 aa AA seqDB search MLEGKAIVKETDMPMKMQIQAMSSASHALDVYDVSDCISIAAFIKKEFDNMYGTGWQCVV GSNFGGFFTHSPGTFMYFALETLNFLIFKRGACS NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgttggaaggaaaagctatagtaaaagaaacagacatgcccatgaagatgcaaatccaa gccatgtcttctgcttctcatgcccttgatgtttatgatgtttctgattgcatttctatt gctgcctttataaagaaggagtttgacaatatgtatgggactggatggcagtgtgtggtg ggttcaaactttggtggtttcttcactcattcgccagggactttcatgtattttgctctg gaaacccttaattttcttatcttcaaaaggggggcttgctcttga

DBGET integrated database retrieval system