Quillaja saponaria (soapbark tree): O6P43_006664 Help Entry O6P43_006664      CDS       T09778                                  Name (GenBank) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism qsa  Quillaja saponaria (soapbark tree) Brite KEGG Orthology (KO) [BR:qsa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:qsa03041]     O6P43_006664   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:qsa04052]     O6P43_006664 Spliceosome [BR:qsa03041]  Complex B   Other components    Complex B specific factors     O6P43_006664 Cytokines and neuropeptides [BR:qsa04052]  Neuropeptides   Unclassified    O6P43_006664 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 OTU1_UBXL Rad60-SLD Ubiquitin_4 Motif Other DBs NCBI-ProteinID:  KAJ7976955 UniProt:  A0AAD7Q8N9 LinkDB All DBs Position 3 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgctcaacgatcggctgggtaagaaggtgagggtgaagtgcaacgac gatgacacgatcggagacttgaagaagctggtggcggctcagactggtaccagagctgac aagattcgtatccagaagtggtataacatctacaaggatcacatcactctcaaggactac gaaatccacgacggcatgggcctcgagctctactataactag

DBGET integrated database retrieval system