Quillaja saponaria (soapbark tree): O6P43_009592 Help Entry O6P43_009592      CDS       T09778                                  Name (GenBank) Eukaryotic initiation factor 4A   KO K03257   translation initiation factor 4A Organism qsa  Quillaja saponaria (soapbark tree) Brite KEGG Orthology (KO) [BR:qsa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:qsa03019]     O6P43_009592    03012 Translation factors [BR:qsa03012]     O6P43_009592   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:qsa04147]     O6P43_009592 Messenger RNA biogenesis [BR:qsa03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     eIF4F and regulatory proteins      O6P43_009592    mRNA cycle factors     Stress granule specific factors      O6P43_009592 Translation factors [BR:qsa03012]  Eukaryotic type   Initiation factors    eIF-4     O6P43_009592 Exosome [BR:qsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    O6P43_009592   Exosomal proteins of bladder cancer cells    O6P43_009592 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  KAJ7971581 UniProt:  A0AAD7PYN1 LinkDB All DBs Position 4:14348296..14361174 Genome browser AA seq 129 aa AA seqDB search MYGKNSFRCPLQVCIPSPPFLSTEMSNLCFQLYSDLDETERAVTLETFLQVLTQWNQIIS SPEGNQDGSGKDEQRSHVLVVTDACLPLLASGESPISGSVLINYKLRAKKETYMRRMATC LAAGSFSDA NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtacggaaagaactcttttcgctgcccacttcaagtctgcatcccaagcccaccgttc ttatccactgaaatgtcaaatttgtgctttcaactgtacagtgaccttgacgaaacagaa cgtgccgttaccttagaaacatttctgcaagtgttaacacaatggaaccaaattattagt tcccccgaaggaaatcaggatgggagtggaaaagatgagcagagatctcatgtactagtt gtaacagatgcttgccttccccttcttgcttctggggagtcacctatttctggcagtgtt ctgattaattacaagttacgagcgaagaaggaaacatatatgaggcgcatggcaacttgt ttggcagctggttctttctctgatgcttag

DBGET integrated database retrieval system