KEGG   Quillaja saponaria (soapbark tree): O6P43_016302
Entry
O6P43_016302      CDS       T09778                                 
Name
(GenBank) putative Skp1
  KO
K03094  S-phase kinase-associated protein 1
Organism
qsa  Quillaja saponaria (soapbark tree)
Pathway
qsa03083  Polycomb repressive complex
qsa04120  Ubiquitin mediated proteolysis
qsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:qsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    O6P43_016302
   04120 Ubiquitin mediated proteolysis
    O6P43_016302
  09126 Chromosome
   03083 Polycomb repressive complex
    O6P43_016302
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:qsa04131]
    O6P43_016302
   04121 Ubiquitin system [BR:qsa04121]
    O6P43_016302
   03036 Chromosome and associated proteins [BR:qsa03036]
    O6P43_016302
Membrane trafficking [BR:qsa04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    O6P43_016302
Ubiquitin system [BR:qsa04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     O6P43_016302
   Cul7 complex
     O6P43_016302
Chromosome and associated proteins [BR:qsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     O6P43_016302
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     O6P43_016302
SSDB
Motif
Pfam: Skp1_POZ Skp1 Methyltransf_16 Ribosomal_L7Ae
Other DBs
NCBI-ProteinID: KAJ7966901
UniProt: A0AAD7M0L5
LinkDB
Position
6
AA seq 157 aa
MSSDRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILARVVEYC
KKHVEAAKTNERASSADEDLKNWDAEFVKVDQATLFDLILAANYLNIKSLLDLNCQTVAD
MIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE
NT seq 474 nt   +upstreamnt  +downstreamnt
atgtcatctgacaggaagataacgctcaagagctcggacggggagaccttcgaggtcgat
gaagccgtggctcttgaatcacagacgattaaacacatgatcgaggacgattgtgccgat
aatggcatccctctgcctaacgtcactagcaagatcttggccagggttgttgagtactgc
aagaaacacgttgaggctgccaagaccaatgagcgagcctccagcgccgacgaggacctc
aagaactgggacgctgaatttgttaaagtcgaccaggccaccctcttcgatcttatcctg
gctgcaaactatctgaacatcaagagcttgctggatttgaattgccagacagtggcagac
atgatcaagggcaaaactcctgaagagatccgcaagacatttaacattaagaatgacttt
acaccagaggaggaagaggaagttcgtagagagaaccaatgggcctttgagtga

DBGET integrated database retrieval system