Quillaja saponaria (soapbark tree): O6P43_017283 Help Entry O6P43_017283      CDS       T09778                                  Name (GenBank) Rac-like GTP-binding protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism qsa  Quillaja saponaria (soapbark tree) Pathway qsa04145   Phagosome qsa04148   Efferocytosis qsa04620   Toll-like receptor signaling pathway qsa05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:qsa00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     O6P43_017283    04148 Efferocytosis     O6P43_017283  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     O6P43_017283  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     O6P43_017283  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:qsa04131]     O6P43_017283   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:qsa04147]     O6P43_017283    04031 GTP-binding proteins [BR:qsa04031]     O6P43_017283 Membrane trafficking [BR:qsa04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     O6P43_017283  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     O6P43_017283   Macropinocytosis    Ras GTPases     O6P43_017283  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     O6P43_017283 Exosome [BR:qsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    O6P43_017283   Exosomal proteins of other body fluids (saliva and urine)    O6P43_017283   Exosomal proteins of colorectal cancer cells    O6P43_017283   Exosomal proteins of bladder cancer cells    O6P43_017283 GTP-binding proteins [BR:qsa04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     O6P43_017283 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Motif Other DBs NCBI-ProteinID:  KAJ7961996 UniProt:  A0AAD7LR75 LinkDB All DBs Position 7 Genome browser AA seq 187 aa AA seqDB search MMNSMMSPRASPAHPTTKFIKCVIVGDGAVGKTSLLISYTSNKFNDGLCDTAGQEDYVRL RPLSYRGTDVFLLTFSLISRPSFENIMRNWVPELKNYGLLSVPIVLVGTKSDLRESEEFM LDHPGLCTISTKQGEELRKQIGAVAYIECSSKKQENVKAVFDAAINSVLHLPNAMKKKKK LRTCNIL NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgatgaatagcatgatgagtcccagggctagccctgcacatcctacaacaaagttcatc aaatgtgtcatagttggagatggtgctgttgggaagacaagccttctcatatcctacact agcaacaaatttaatgatggtctctgtgatactgctggtcaagaagattatgtcaggctg aggcctctgtcctatagaggaactgatgtgtttcttcttaccttttccctcatcagtagg cctagctttgagaacataatgaggaattgggtgccagagttgaaaaattatggcctctta tcagtacccattgttcttgtggggactaaatcagatctgagggaaagtgaggaatttatg ttagatcatcctgggctttgtaccatctctacaaaacagggtgaagaactgaggaaacag attggagcagttgcatacatagagtgtagctccaagaaacaggagaatgtgaaggctgtt tttgatgctgctatcaactcagttctccatctgccaaatgccatgaagaaaaagaagaaa ctgaggacctgcaatattctttga

DBGET integrated database retrieval system