Quillaja saponaria (soapbark tree): O6P43_018372 Help Entry O6P43_018372      CDS       T09778                                  Name (GenBank) Ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism qsa  Quillaja saponaria (soapbark tree) Pathway qsa04136   Autophagy - other Brite KEGG Orthology (KO) [BR:qsa00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     O6P43_018372  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:qsa04131]     O6P43_018372    04121 Ubiquitin system [BR:qsa04121]     O6P43_018372    03029 Mitochondrial biogenesis [BR:qsa03029]     O6P43_018372 Membrane trafficking [BR:qsa04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     O6P43_018372 Ubiquitin system [BR:qsa04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    O6P43_018372 Mitochondrial biogenesis [BR:qsa03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     O6P43_018372 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 DUF4264 Motif Other DBs NCBI-ProteinID:  KAJ7963250 UniProt:  A0AAD7LUD0 LinkDB All DBs Position 7 Genome browser AA seq 94 aa AA seqDB search MAAEPPSSVRKVVVHLRATGDAPILKQAKFKIPGTDKFAKVIDFLRRQLHRETLFVYVNS AFSPNPDELVIDLYNNFGFDGKLVVNYACSMAWG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggctgcggagcctccaagctctgttcgtaaagtggtcgttcatttgagagccaccggt gacgctccgatactcaagcaagcgaaatttaagataccaggtaccgacaagtttgctaaa gtgatagacttcctccgccgtcaactccatcgggagacattgtttgtgtatgtcaacagt gctttctcaccgaaccctgatgaattggttattgatctatataataatttcggttttgat gggaaactagtggttaactacgcttgttccatggcatggggctaa

DBGET integrated database retrieval system