Quillaja saponaria (soapbark tree): O6P43_027762 Help Entry O6P43_027762      CDS       T09778                                  Name (GenBank) Dynein light chain   KO K10418   dynein light chain LC8-type Organism qsa  Quillaja saponaria (soapbark tree) Pathway qsa04814   Motor proteins Brite KEGG Orthology (KO) [BR:qsa00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     O6P43_027762  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:qsa03037]     O6P43_027762    04812 Cytoskeleton proteins [BR:qsa04812]     O6P43_027762 Cilium and associated proteins [BR:qsa03037]  Motile cilia and associated proteins   Dynein arm    O6P43_027762 Cytoskeleton proteins [BR:qsa04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      O6P43_027762 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-ProteinID:  KAJ7951763 UniProt:  A0AAD7PDP3 LinkDB All DBs Position 11 Genome browser AA seq 98 aa AA seqDB search MLEGKALIEDTDMPSKMQIQAMASASEALDLYDVLDCKSIAAHIKQGFDMRYGSGWQCVV GSSFGCFFTHSKGTFIYFTLETLNFLIFKGATSSSFSS NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgttggaaggtaaagctttgatagaggacactgacatgccatccaagatgcagatccaa gccatggcatctgcttctgaagctctggatctctatgatgttcttgattgcaaatccatt gctgcccacataaaacaggggtttgacatgagatatgggagtggatggcaatgtgtggtg ggttcaagttttgggtgttttttcactcattctaaaggaactttcatatactttacattg gagactctcaatttccttatcttcaaaggagctacttcatcctctttctcttcatga

DBGET integrated database retrieval system