Qipengyuania soli: IRL76_03730 Help Entry IRL76_03730       CDS       T09808                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism qso  Qipengyuania soli Brite KEGG Orthology (KO) [BR:qso00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:qso03032]     IRL76_03730    03036 Chromosome and associated proteins [BR:qso03036]     IRL76_03730    03400 DNA repair and recombination proteins [BR:qso03400]     IRL76_03730 DNA replication proteins [BR:qso03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     IRL76_03730 Chromosome and associated proteins [BR:qso03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     IRL76_03730 DNA repair and recombination proteins [BR:qso03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       IRL76_03730 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 VWA_3 DUF2267 Motif Other DBs NCBI-ProteinID:  QPC99684 UniProt:  A0A7S8F5Q8 LinkDB All DBs Position 739140..739412 Genome browser AA seq 90 aa AA seqDB search MNKNDLISAVADASGLSKSDASSAVEGVFDSITKALSKGDEVRLVGFGTFSVAKRKASTG RNPRTGEPMTIKASNQPKFKAGKGLKDSVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagaacgacctgatcagcgcggttgccgatgccagtggcctttccaagagtgat gcttcgagcgccgtcgagggcgtgttcgattcgatcaccaaggcactgtccaagggcgat gaagtccgcctggttggcttcggcacgttctcggtcgcgaaacgcaaggcctcgaccggc cgcaacccgcgcactggcgaaccgatgaccatcaaggcatcgaaccagccgaagttcaag gccggcaagggcctcaaggattcggtcaactga

DBGET integrated database retrieval system