Qipengyuania spongiae: L1F33_00515 Help Entry L1F33_00515       CDS       T08950                                  Name (GenBank) tautomerase family protein   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism qsp  Qipengyuania spongiae Pathway qsp00362   Benzoate degradation qsp01100   Metabolic pathways qsp01120   Microbial metabolism in diverse environments qsp01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:qsp00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     L1F33_00515    00622 Xylene degradation     L1F33_00515    00621 Dioxin degradation     L1F33_00515 Enzymes [BR:qsp01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      L1F33_00515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Motif Other DBs NCBI-ProteinID:  UVI39482 LinkDB All DBs Position 98457..98708 Genome browser AA seq 83 aa AA seqDB search MPHIAVTMHSADAEKAELADRLSAAVTRTLGYGSEAVSVLVEDVVPSQWMDQIYRPQIDA HPGRLVKRPGYGPLSEQNEGEHS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgccccatatcgccgtcaccatgcattccgccgatgcggagaaggccgaactcgccgac aggttgagcgccgcagtcaccagaacgctcggctacggttccgaggcggtgtccgttttg gtcgaggatgtggtcccgtcccaatggatggaccaaatctaccgtccccagatcgacgcg catccgggccggctggtgaaacggcccggatacgggccgctgtccgaacagaacgaagga gagcattcgtga

DBGET integrated database retrieval system