Qipengyuania spongiae: L1F33_10020 Help Entry L1F33_10020       CDS       T08950                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism qsp  Qipengyuania spongiae Pathway qsp01100   Metabolic pathways qsp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:qsp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     L1F33_10020    00074 Mycolic acid biosynthesis     L1F33_10020   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     L1F33_10020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  UVI38584 LinkDB All DBs Position 2004302..2004538 Genome browser AA seq 78 aa AA seqDB search MSDTADRVQKIVVEHLGVEADKVTQDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA ENITTVGDATKYIEEHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatactgccgaccgcgtgcagaagattgtcgtcgagcatctcggcgtcgaggcc gacaaggtcacccaggatgccagcttcatcgacgatctgggggcggacagcctcgacatc gtcgaactcgtcatggctttcgaggaagaattcggcgtggaaatccccgacgatgcggcg gaaaacatcaccaccgtcggcgatgccaccaagtacatcgaagagcacaagggctaa

DBGET integrated database retrieval system