Quercus suber (cork oak): 111998273 Help Entry 111998273         CDS       T05868                                  Name (RefSeq) polyubiquitin isoform X1   KO K03873   elongin-B Organism qsu  Quercus suber (cork oak) Pathway qsu04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:qsu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     111998273  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:qsu04121]     111998273    03400 DNA repair and recombination proteins [BR:qsu03400]     111998273 Ubiquitin system [BR:qsu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      111998273    Cul5 complex      111998273 DNA repair and recombination proteins [BR:qsu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      111998273 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Dsc3_N UBL_UBAC1 Rad60-SLD_2 DUF2604 Motif Other DBs NCBI-GeneID:  111998273 NCBI-ProteinID:  XP_065625147 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MAMYIRVKRSKTTYFIRCDPTETVLDIKEKLQVLIDQPVNNQRLILVGTGEVLEDSKTLA DHKVENDSVVALTLRKGGLLNSFLSDFYASPVYYWVPLCIFYVADRSLNS NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggctatgtatatccgagttaagcgtagtaagacaacttacttcatacggtgtgatcct actgaaacagttctagacataaaggagaaattgcaagtcctcattgatcaaccagttaac aatcagcgtttgatcctagttggtactggggaagttttagaggattcaaagacattggca gatcataaggttgaaaatgattcagttgtggcactgaccttgagaaaaggtggtcttctt aattctttcctctctgatttttatgcatcacctgtgtactactgggtacccttgtgcatt ttttatgttgctgataggagtctgaacagctaa

DBGET integrated database retrieval system