Quercus suber (cork oak): 112000075 Help Entry 112000075         CDS       T05868                                  Name (RefSeq) protein MHF1 homolog isoform X2   KO K11511   centromere protein S Organism qsu  Quercus suber (cork oak) Pathway qsu03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:qsu00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     112000075  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:qsu03036]     112000075    03400 DNA repair and recombination proteins [BR:qsu03400]     112000075 Chromosome and associated proteins [BR:qsu03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      112000075 DNA repair and recombination proteins [BR:qsu03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      112000075 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C TFIID-31kDa Bromo_TP DUF1175 DUF5073 DUF6989 Motif Other DBs NCBI-GeneID:  112000075 NCBI-ProteinID:  XP_023887947 LinkDB All DBs Position Unknown AA seq 143 aa AA seqDB search MEKAMDMDMEMEREEEEEEETESVSDVLRDRFRLSTISIAEAEAKRNGMEISEPIVACIS DLAFKYAEQLAKDLELFAQHASRKIVKMEDVILSAHRNEHLATSLRSLCDDLKAKEPQSE RKRKKTPRKENKATTSVVHIPDN NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atggaaaaggcaatggacatggacatggaaatggaaagagaagaagaagaagaagaagaa acagagtcagtgagcgatgtgttgagagatcgattccgcctctccaccatctctattgct gaagccgaagcgaaaagaaatgggatggaaatatccgaacccattgtcgcttgcatttcc gatttggccttcaaatatgcagagcagctggcaaaggaccttgagctatttgcacagcat gccagtcgcaaaattgtaaagatggaagatgtcatactttctgcacacagaaacgaacat ctagctacctctttgaggtccttatgcgatgatctgaaagctaaagaaccccaatccgag aggaagcggaagaagacgccaagaaaggagaacaaagcaactacaagtgtagtgcatatt cctgataactaa

DBGET integrated database retrieval system