Quercus suber (cork oak): 112010467 Help Entry 112010467         CDS       T05868                                  Name (RefSeq) sm-like protein LSM8   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism qsu  Quercus suber (cork oak) Pathway qsu03018   RNA degradation qsu03040   Spliceosome Brite KEGG Orthology (KO) [BR:qsu00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     112010467   09123 Folding, sorting and degradation    03018 RNA degradation     112010467  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:qsu03019]     112010467    03041 Spliceosome [BR:qsu03041]     112010467 Messenger RNA biogenesis [BR:qsu03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      112010467   mRNA degradation factors    5'-3' decay     Lsm complex      112010467 Spliceosome [BR:qsu03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     112010467 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM DUF150_C Motif Other DBs NCBI-GeneID:  112010467 NCBI-ProteinID:  XP_065634507 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search MSGGPGLESLVDQTISVITNDGRNIVGVLKGFDQATNIILDESHERVYSTKVCILTMISL QLQFVLLLCSLNGTNYTFTAPAVLGLYIIRGDNISVVGELDEELDAHLDLSKLRAHPLKP VIH NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgtcaggtggccctggacttgaatctcttgtagatcaaacaatatcagttatcacaaat gatggacggaacatagtgggagtcttaaaaggctttgaccaggctacaaatattatcctt gatgaatctcatgagcgtgtctactccacaaaggtttgtatccttactatgataagcctt cagttacagtttgttttactcctatgttcactgaatggaacaaattacacatttactgcc cctgctgtgttgggtttgtatataatcaggggtgacaacataagcgtagttggggagctc gatgaggagcttgatgctcatcttgatttgtcaaaactgagggctcatcctctcaagcct gtcatccattaa

DBGET integrated database retrieval system