Quercus suber (cork oak): 112013274 Help Entry 112013274         CDS       T05868                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism qsu  Quercus suber (cork oak) Pathway qsu04145   Phagosome qsu04148   Efferocytosis qsu04620   Toll-like receptor signaling pathway qsu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:qsu00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     112013274    04148 Efferocytosis     112013274  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112013274  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     112013274  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:qsu04131]     112013274   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:qsu04147]     112013274    04031 GTP-binding proteins [BR:qsu04031]     112013274 Membrane trafficking [BR:qsu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     112013274  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     112013274   Macropinocytosis    Ras GTPases     112013274  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     112013274 Exosome [BR:qsu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112013274   Exosomal proteins of other body fluids (saliva and urine)    112013274   Exosomal proteins of colorectal cancer cells    112013274   Exosomal proteins of bladder cancer cells    112013274 GTP-binding proteins [BR:qsu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     112013274 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  112013274 NCBI-ProteinID:  XP_023901439 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPITTAQGEELRKLIGSPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKKAQKGCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtccaggttcatcaagtgcgtcaccgtcggcgacggcgctgtcggcaaaact tgcatgttgatttcctataccagcaacactttccctacggactatgtgccaacggttttt gacaacttcagtgcaaatgtggttgtggatggaagcaccgttaaccttgggctatgggat actgctggtcaggaggattacaataggttaagacccttgagctatcgaggtgcagatgtg tttattcttgctttctctctcataagcaaggccagctatgaaaatgttgcaaaaaagtgg attcctgaattgaggcattacgcacctggagttccaataatcctcgttggaacaaagctc gatcttagggatgataagcagttctttatcgatcatccaggtgcagtgcccatcactacg gctcagggagaagagcttaggaaactgattggatctcctgcctacattgagtgtagctca aaaacacagcagaatgttaaggcagtttttgatgcagccattaaggttgtgctacagcca ccaaagcaaaagaagaaaaagaaaaaggcacaaaagggttgttccatattgtga

DBGET integrated database retrieval system