Quercus suber (cork oak): 112013274 Help Entry 112013274         CDS       T05868                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism qsu  Quercus suber (cork oak) Pathway qsu04145   Phagosome qsu04148   Efferocytosis qsu04517   IgSF CAM signaling qsu04518   Integrin signaling qsu04620   Toll-like receptor signaling pathway qsu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:qsu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     112013274    04518 Integrin signaling     112013274  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     112013274    04148 Efferocytosis     112013274  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112013274  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     112013274  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:qsu04131]     112013274   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:qsu04147]     112013274    04031 GTP-binding proteins [BR:qsu04031]     112013274 Membrane trafficking [BR:qsu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     112013274  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     112013274   Macropinocytosis    Ras GTPases     112013274  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     112013274 Exosome [BR:qsu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112013274   Exosomal proteins of other body fluids (saliva and urine)    112013274   Exosomal proteins of colorectal cancer cells    112013274   Exosomal proteins of bladder cancer cells    112013274 GTP-binding proteins [BR:qsu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     112013274 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  112013274 NCBI-ProteinID:  XP_023901439 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPITTAQGEELRKLIGSPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKKAQKGCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtccaggttcatcaagtgcgtcaccgtcggcgacggcgctgtcggcaaaact tgcatgttgatttcctataccagcaacactttccctacggactatgtgccaacggttttt gacaacttcagtgcaaatgtggttgtggatggaagcaccgttaaccttgggctatgggat actgctggtcaggaggattacaataggttaagacccttgagctatcgaggtgcagatgtg tttattcttgctttctctctcataagcaaggccagctatgaaaatgttgcaaaaaagtgg attcctgaattgaggcattacgcacctggagttccaataatcctcgttggaacaaagctc gatcttagggatgataagcagttctttatcgatcatccaggtgcagtgcccatcactacg gctcagggagaagagcttaggaaactgattggatctcctgcctacattgagtgtagctca aaaacacagcagaatgttaaggcagtttttgatgcagccattaaggttgtgctacagcca ccaaagcaaaagaagaaaaagaaaaaggcacaaaagggttgttccatattgtga

DBGET integrated database retrieval system