Quercus suber (cork oak): 112016333 Help Entry 112016333         CDS       T05868                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism qsu  Quercus suber (cork oak) Pathway qsu03083   Polycomb repressive complex qsu04120   Ubiquitin mediated proteolysis qsu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:qsu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112016333    04120 Ubiquitin mediated proteolysis     112016333   09126 Chromosome    03083 Polycomb repressive complex     112016333  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:qsu04131]     112016333    04121 Ubiquitin system [BR:qsu04121]     112016333    03036 Chromosome and associated proteins [BR:qsu03036]     112016333 Membrane trafficking [BR:qsu04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     112016333 Ubiquitin system [BR:qsu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      112016333    Cul7 complex      112016333 Chromosome and associated proteins [BR:qsu03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      112016333   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      112016333 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ DarP Motif Other DBs NCBI-GeneID:  112016333 NCBI-ProteinID:  XP_065628333 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MSSVKKVTLKSSDGEIFEVEETVAMESQTIKGLIEDDCADNAIPLPNVTGHILSLVIQYC KEHTSSSDSNSSKSNEKLKAWDTQFINVDLNVLFDLIMAANYLNVKGLLDLTCQTVADMI KEKTPEQIRAMFNIVNDFTPEEEEEVRRENAWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcttcggtgaagaaggtgacgctgaagagctcagatggcgagattttcgaggtggaa gagactgtggcgatggagtcacagacgataaagggcttgatcgaagatgactgtgccgac aatgcaatcccattgcctaacgtaacaggccacatactttcactcgtcatccagtactgc aaggagcacacgtcctcctctgactctaactcttccaagtccaatgagaagctcaaggcc tgggatacccagttcatcaatgtcgacctgaacgtcctctttgatctcatcatggcggcc aactatttgaacgttaaggggctattggatttaacttgccagactgtggcagacatgata aaggaaaagactccagaacagattcgtgcgatgttcaatattgtgaatgatttcactcca gaagaagaagaggaggttcgaagggagaatgcgtgggcatttgagtga

DBGET integrated database retrieval system