Quercus suber (cork oak): 112020714 Help Entry 112020714         CDS       T05868                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism qsu  Quercus suber (cork oak) Pathway qsu04136   Autophagy - other Brite KEGG Orthology (KO) [BR:qsu00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     112020714  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:qsu04131]     112020714    04121 Ubiquitin system [BR:qsu04121]     112020714    03029 Mitochondrial biogenesis [BR:qsu03029]     112020714 Membrane trafficking [BR:qsu04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     112020714 Ubiquitin system [BR:qsu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    112020714 Mitochondrial biogenesis [BR:qsu03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     112020714 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 DUF4264 Motif Other DBs NCBI-GeneID:  112020714 NCBI-ProteinID:  XP_065623998 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MAAESQSPSSVKKVVVHLRATGDAPILKQAKFKIPGTDKFAKVIDFLRRQLHRETLFVYV NSAFSPNPDELVIDLYNNFGFDGKLVVNYACSMAWG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcagctgagtctcagtctccgagttctgttaaaaaagtggttgttcatctgagagcc actggtgatgctcctattctcaagcaagcgaaattcaagatacctggaactgacaagttt gctaaagtaattgactttctacgccgacaacttcatcgggaaacattgtttgtctatgtc aacagtgcattctctccaaacccagatgaattggtgattgatctgtataataattttggt tttgatggtaaactggtggttaattatgcttgttccatggcatggggctaa

DBGET integrated database retrieval system