Quercus suber (cork oak): 112031636 Help Entry 112031636         CDS       T05868                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism qsu  Quercus suber (cork oak) Pathway qsu04145   Phagosome qsu04148   Efferocytosis qsu04517   IgSF CAM signaling qsu04518   Integrin signaling qsu04620   Toll-like receptor signaling pathway qsu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:qsu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     112031636    04518 Integrin signaling     112031636  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     112031636    04148 Efferocytosis     112031636  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112031636  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     112031636  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:qsu04131]     112031636   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:qsu04147]     112031636    04031 GTP-binding proteins [BR:qsu04031]     112031636 Membrane trafficking [BR:qsu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     112031636  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     112031636   Macropinocytosis    Ras GTPases     112031636  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     112031636 Exosome [BR:qsu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112031636   Exosomal proteins of other body fluids (saliva and urine)    112031636   Exosomal proteins of colorectal cancer cells    112031636   Exosomal proteins of bladder cancer cells    112031636 GTP-binding proteins [BR:qsu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     112031636 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  112031636 NCBI-ProteinID:  XP_023920104 LinkDB All DBs Position Unknown AA seq 211 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGL WDTAGQEDYNRLRPLSYRGGDVFVLAFSLVSRASYENVLKKWIPELQHYAPGIPVVLVGT KLDLREDKHYLADHPGMVPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAAIKVVI KPPQKQKEKKKKPRRGCLLNVFRGSSFVCLK NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggcttcaagtgcttcaaggttcatcaagtgtgtgacagttggagatggggctgttggg aagacctgcatgcttatttgctatacaagtaacaaattccccactgattatatacccaca gtgtttgataacttcagtgcaaatgtggtggttgaaggcaccactgttaacttaggactc tgggacacagctgggcaagaggattacaatagattaaggccattgagctacagaggggga gatgtctttgtcttagctttctcactagttagtcgtgcaagctatgaaaacgtacttaaa aagtggatccctgaacttcagcattatgcccctggcattcccgtggttctggttggcacc aaattggatcttcgtgaggataagcactatttggctgatcatccaggaatggtgcctgtg acgactgcacagggcgaggaactccgtaaacagattggtgctgcatattatatagaatgc agctcaaaaactcagcagaatgtgaaagcagtttttgatgctgcaatcaaggtggtcatc aagccaccacagaagcaaaaagagaagaagaaaaagccacgtcgcggatgcctattaaat gtttttcgtgggagcagtttcgtgtgtctcaaatga

DBGET integrated database retrieval system