Quercus suber (cork oak): 112035771 Help Entry 112035771         CDS       T05868                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism qsu  Quercus suber (cork oak) Pathway qsu03083   Polycomb repressive complex qsu04120   Ubiquitin mediated proteolysis qsu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:qsu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112035771    04120 Ubiquitin mediated proteolysis     112035771   09126 Chromosome    03083 Polycomb repressive complex     112035771  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:qsu04131]     112035771    04121 Ubiquitin system [BR:qsu04121]     112035771    03036 Chromosome and associated proteins [BR:qsu03036]     112035771 Membrane trafficking [BR:qsu04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     112035771 Ubiquitin system [BR:qsu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      112035771    Cul7 complex      112035771 Chromosome and associated proteins [BR:qsu03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      112035771   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      112035771 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  112035771 NCBI-ProteinID:  XP_023924370 LinkDB All DBs Position Unknown AA seq 150 aa AA seqDB search MANQDAILNSTATSTMRITLKSADDKLFMVKEAIAMEFGVLKFFLEDSTDLESTVIPLLN VSGSVLGRVIHYCEKSLSLHLILPPSTVLHLFERVAELILDDENDESIVELVKAADYLDI KVLLAFLMPSFKRRFELGDDKGVEYVYREM NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atggcgaaccaagacgcaatcctaaactctaccgcaaccagcacgatgaggataacgctg aaatccgctgacgacaagctattcatggtgaaggaagccatagcgatggagttcggcgta ctgaagttcttcctcgaagacagcaccgatttggagagcactgtgatccctctgctaaac gtgtctggctccgttcttggccgtgtcatccactactgcgagaaaagcctgagtctccac ttgatactccctccgtcgactgtgcttcatttatttgaacgagtagcggagttgattttg gatgacgagaacgacgagagcatcgttgagctggttaaggcagccgattacttggacatc aaggtactgctggcattcttgatgccgagcttcaagaggaggtttgaactcggagacgat aagggtgtagaatatgtttatagggagatgtag

DBGET integrated database retrieval system