Quercus suber (cork oak): 112036470 Help Entry 112036470         CDS       T05868                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism qsu  Quercus suber (cork oak) Brite KEGG Orthology (KO) [BR:qsu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:qsu03041]     112036470   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:qsu04052]     112036470 Spliceosome [BR:qsu03041]  Complex B   Other components    Complex B specific factors     112036470 Cytokines and neuropeptides [BR:qsu04052]  Neuropeptides   Unclassified    112036470 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Crinkler Motif Other DBs NCBI-GeneID:  112036470 NCBI-ProteinID:  XP_065637146 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKNHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatagaggtggtgctgaacgatcggttggggaagaaggttcgtgtgaagtgcaacgag gatgacaccataggcgacctgaagaagcttgtggcggctcagactggtacgagggccgac aagattaggatccagaagtggtacaacatctacaaaaaccacatcactctcaaggattac gagattcacgatggcatgggcctcgagctctactacaactaa

DBGET integrated database retrieval system