Quercus suber (cork oak): 112040703 Help Entry 112040703         CDS       T05868                                  Name (RefSeq) sm-like protein LSM7   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism qsu  Quercus suber (cork oak) Pathway qsu03018   RNA degradation qsu03040   Spliceosome Brite KEGG Orthology (KO) [BR:qsu00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     112040703   09123 Folding, sorting and degradation    03018 RNA degradation     112040703  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:qsu03019]     112040703    03041 Spliceosome [BR:qsu03041]     112040703 Messenger RNA biogenesis [BR:qsu03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      112040703   mRNA degradation factors    5'-3' decay     Lsm complex      112040703 Spliceosome [BR:qsu03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     112040703 SSDB OrthologParalogGFIT Motif Pfam:  LSM Hfq RimP_C Motif Other DBs NCBI-GeneID:  112040703 NCBI-ProteinID:  XP_023929362 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MSGSRKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDPDDPLK TTDQTRRLGLIVCRGTAVMLVSPTDGTDEIANPFIQPEGA NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgtcaggaagcaggaaagaaacagttttggacttggcaaagtttgtggacaaaggtgtc caagtcaagctcactggtggtagacaagtgacagggactctaaagggatatgatcagtta ctaaaccttgttttggatgaagctgtagagtttttgagagatcctgatgatccactgaag actactgatcaaaccaggcgcctgggcctaatagtttgcaggggaaccgctgtaatgctt gtgtccccgacagacggcacagatgagattgccaacccttttatccagccagaaggggcc tag

DBGET integrated database retrieval system