KEGG   Qipengyuania xiapuensis: K3162_08885
Entry
K3162_08885       CDS       T10368                                 
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
qxi  Qipengyuania xiapuensis
Pathway
qxi00190  Oxidative phosphorylation
qxi01100  Metabolic pathways
qxi02020  Two-component system
qxi04148  Efferocytosis
Module
qxi_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:qxi00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    K3162_08885 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    K3162_08885 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    K3162_08885 (petA)
Enzymes [BR:qxi01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     K3162_08885 (petA)
SSDB
Motif
Pfam: UCR_Fe-S_N Rieske
Other DBs
NCBI-ProteinID: QZD91671
UniProt: A0ABX8ZRN8
LinkDB
Position
1737907..1738479
AA seq 190 aa
MADTTATANPETPTTGEDGVRRRDFLDIAAVSAAGIGGLAVVYPLVSQMAPSKDVLAASS
TEVDISSIEPGQAIKAVFRKQPLFVKRLTPAEIEAANATATGSLRDPQSLADRTKEGHED
ILVTMGVCTHLGCVPLGAAEGEVKGEFGGYFCPCHGSHYDTAGRIRKGPAPTNLEVPEYE
FTSDTVIQVG
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcagacacgactgcaaccgctaatcccgaaacacccaccacgggcgaagacggcgtt
cgtcgccgcgacttcctcgacatcgcagccgtcagtgcggcaggcatcggcggtctcgcc
gtggtctatccgctggtgagccagatggcgccctcgaaggacgtgctcgcagcgagttcg
accgaagtcgacatctcgtcgatcgagccgggacaggccatcaaggccgtgttccgcaag
cagccgctcttcgtgaagcgcctgacgccagccgaaatcgaagctgccaacgcaaccgcc
accggttcgctgcgcgacccgcagagcctcgccgaccgcaccaaggaaggccacgaggac
atcctcgtaacgatgggcgtctgcacccacctcggctgcgtgccgctgggcgctgcagaa
ggtgaagtgaagggcgaattcggcggctatttctgcccctgccacggttcgcactacgat
accgcaggtcgcatccgtaaaggccctgcgcccaccaacctcgaagtgccggaatacgag
ttcacctcggacaccgtcatccaggtcggctga

DBGET integrated database retrieval system