Rickettsia amblyommatis Ac37: AL573_06825 Help Entry AL573_06825       CDS       T04237                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rab  Rickettsia amblyommatis Ac37 Pathway rab01100   Metabolic pathways rab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rab00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AL573_06825    00074 Mycolic acid biosynthesis     AL573_06825   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AL573_06825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L50 DUF1493 PP-binding_2 Motif Other DBs NCBI-ProteinID:  ALA62216 LinkDB All DBs Position 1306696..1306941 Genome browser AA seq 81 aa AA seqDB search MSTTDKIEQKVIEMVAEKLNKDKSIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPD DEATKIKTVSDVIKYIKERQS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagtacaacggataagatcgaacagaaagttattgaaatggttgctgaaaagctaaat aaagataaatcgataataactacggattcaagatttatagaagatttgaaagccgatagc cttgataccgtagagttaatgatggcaatagaagttgaatacggtattgatatccctgat gatgaagccactaaaattaaaaccgtatccgatgttataaaatatatcaaagaacgccaa tcttaa

DBGET integrated database retrieval system