Rahnella aceris ZF458: JHW33_21200 Help Entry JHW33_21200       CDS       T07163                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism race  Rahnella aceris ZF458 Pathway race01100   Metabolic pathways race01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:race00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JHW33_21200    00074 Mycolic acid biosynthesis     JHW33_21200   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JHW33_21200 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QQN34867 LinkDB All DBs Position 4615309..4615566 Genome browser AA seq 85 aa AA seqDB search MDSLSNDIKALIIETLNLEGMTPDEIETQAPLFGDGLGLDSIDALELGLALKKQYGVILS AESQEMREHFYSVESLARFISVQRG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggattcattaagtaacgacataaaagcacttatcattgagacgctgaatctggaagga atgacgccagatgagatagagacgcaggccccactttttggtgacggattagggctggat tctattgatgcccttgagcttggtctggcattaaagaagcaatacggtgtgatcctttcg gcggaaagtcaggaaatgcgcgagcacttttattctgttgaaagtttggccagatttata tcagtacagcgtggttaa

DBGET integrated database retrieval system