Riemerella anatipestifer RA-CH-2: G148_1206
Help
Entry
G148_1206 CDS
T02438
Name
(GenBank) hypothetical protein
KO
K06891
ATP-dependent Clp protease adaptor protein ClpS
Organism
rae
Riemerella anatipestifer RA-CH-2
Brite
KEGG Orthology (KO) [BR:
rae00001
]
09190 Not Included in Pathway or Brite
09192 Unclassified: genetic information processing
99975 Protein processing
G148_1206
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ClpS
DUF3276
Motif
Other DBs
NCBI-ProteinID:
AGC40510
LinkDB
All DBs
Position
1278388..1278675
Genome browser
AA seq
95 aa
AA seq
DB search
MVFQNIPNKENEEEVSVLSSTEAKHKLVLHNDDFNTFDFVIESLMEVCAHTLEQAEQCTF
LVHYKGKCTVKTGNLELIEPMHKKLLLRGLSSEII
NT seq
288 nt
NT seq
+upstream
nt +downstream
nt
atggtttttcaaaatatccctaataaagagaacgaagaagaggttagcgttttgtcttcc
actgaagcgaagcataaacttgtattgcataatgatgattttaacacctttgatttcgtt
atagagtctcttatggaagtatgtgctcatacattagaacaggcagaacaatgtacgttc
ttggtacattataaaggtaaatgtactgtgaaaacaggtaatttagaactgattgagcct
atgcacaaaaaactacttttaagagggctatctagtgaaataatctaa
DBGET
integrated database retrieval system